SCOPe 2.08: Domain d2hw3a1: 2hw3 A:297-468

Lineage for d2hw3a1 (2hw3 A:297-468)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (40 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [255224] (2 PDB entries)

8. Domain d2hw3a1: 2hw3 A:297-468 [136819]
   Other proteins in same PDB: d2hw3a2
   automated match to d4dqqd1
   protein/DNA complex; complexed with mg, so4

Details for d2hw3a1

PDB Entry: 2hw3, 1.98 Å

PDB Description: t:o6-methyl-guanine pair in the polymerase postinsertion site (-1 basepair position)

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hw3a1:

Sequence; same for both SEQRES and ATOM records:

>d2hw3a1 c.55.3.0 (A:297-468) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d2hw3a1:

• d2hw3a1 first appeared in SCOP 1.73
  
• d2hw3a1 appears in SCOPe 2.07