Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [255224] (2 PDB entries) |
Domain d2hw3a1: 2hw3 A:297-468 [136819] Other proteins in same PDB: d2hw3a2 automated match to d4dqqd1 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 2hw3 (more details), 1.98 Å
SCOPe Domain Sequences for d2hw3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hw3a1 c.55.3.0 (A:297-468) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d2hw3a1: