![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
![]() | Protein Potassium channel protein [56901] (2 species) |
![]() | Species Streptomyces lividans [TaxId:1916] [161074] (17 PDB entries) |
![]() | Domain d2hvjc_: 2hvj C: [136812] Other proteins in same PDB: d2hvja1, d2hvja2, d2hvjb1, d2hvjb2 automated match to d1r3jc_ complexed with f09, k, l2c, tba |
PDB Entry: 2hvj (more details), 2.75 Å
SCOPe Domain Sequences for d2hvjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvjc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2hvjc_:
![]() Domains from other chains: (mouse over for more information) d2hvja1, d2hvja2, d2hvjb1, d2hvjb2 |