SCOPe 2.04: Domain d2hvhd1: 2hvh D:297-468

Lineage for d2hvhd1 (2hvh D:297-468)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (43 PDB entries)
   Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462

8. Domain d2hvhd1: 2hvh D:297-468 [136806]
   Other proteins in same PDB: d2hvha2, d2hvhd2
   protein/DNA complex; complexed with dct, mn, so4, suc

Details for d2hvhd1

PDB Entry: 2hvh, 2.49 Å

PDB Description: ddctp:o6meg pair in the polymerase active site (0 position)

PDB Compounds: (D:) DNA polymerase I

SCOPe Domain Sequences for d2hvhd1:

Sequence; same for both SEQRES and ATOM records:

>d2hvhd1 c.55.3.5 (D:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d2hvhd1:

• d2hvhd1 first appeared in SCOP 1.73
  
• d2hvhd1 appears in SCOPe 2.03
  
• d2hvhd1 appears in SCOPe 2.05
  
• d2hvhd1 appears in the current release, SCOPe 2.08