Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.31: Eferin C-derminal domain-like [144270] (1 family) |
Family h.1.31.1: Eferin C-derminal domain-like [144271] (2 proteins) contains PfamB PB042332, PfamB PB026102 |
Protein Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) [144274] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144275] (2 PDB entries) Uniprot O75154 703-756! Uniprot O75154 715-756 |
Domain d2hv8e1: 2hv8 E:703-756 [136798] Other proteins in same PDB: d2hv8a_, d2hv8b_, d2hv8c_ automatically matched to 2HV8 D:703-756 complexed with 2me, gtp, mes, mg, so4 |
PDB Entry: 2hv8 (more details), 1.86 Å
SCOPe Domain Sequences for d2hv8e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hv8e1 h.1.31.1 (E:703-756) Rab11 family-interacting protein 3 (Rab11-FIP3, Eferin) {Human (Homo sapiens) [TaxId: 9606]} afseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk
Timeline for d2hv8e1:
View in 3D Domains from other chains: (mouse over for more information) d2hv8a_, d2hv8b_, d2hv8c_, d2hv8d1 |