SCOP 1.73: Domain d2hv8c1: 2hv8 C:8-173

Lineage for d2hv8c1 (2hv8 C:8-173)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102363] (9 PDB entries)

8. Domain d2hv8c1: 2hv8 C:8-173 [136796]
   Other proteins in same PDB: d2hv8d1, d2hv8e1
   automatically matched to d1oiwa_
   complexed with 2me, gtp, mes, mg, so4; mutant

Details for d2hv8c1

PDB Entry: 2hv8, 1.86 Å

PDB Description: crystal structure of gtp-bound rab11 in complex with fip3

PDB Compounds: (C:) Ras-related protein Rab-11A

SCOP Domain Sequences for d2hv8c1:

Sequence; same for both SEQRES and ATOM records:

>d2hv8c1 c.37.1.8 (C:8-173) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d2hv8c1:

• d2hv8c1 is new in SCOP 1.73
  
• d2hv8c1 appears in SCOP 1.75
  
• d2hv8c1 appears in the current release, SCOPe 2.08, called d2hv8c_