SCOPe 2.05: Domain d2hu6a_: 2hu6 A:

Lineage for d2hu6a_ (2hu6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d2hu6a_: 2hu6 A: [136767]
   automated match to d1os2a_
   complexed with 37a, ca, hae, zn

Details for d2hu6a_

PDB Entry: 2hu6, 1.32 Å

PDB Description: crystal structure of human mmp-12 in complex with acetohydroxamic acid and a bicyclic inhibitor

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2hu6a_:

Sequence; same for both SEQRES and ATOM records:

>d2hu6a_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d2hu6a_:

• d2hu6a_ first appeared in SCOP 1.73, called d2hu6a1
  
• d2hu6a_ appears in SCOPe 2.04
  
• d2hu6a_ appears in SCOPe 2.06
  
• d2hu6a_ appears in the current release, SCOPe 2.08