Lineage for d2htnh1 (2htn H:1-158)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766114Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
    binds heme between two subunits; 24-mer
  7. 766189Species Escherichia coli [TaxId:562] [47245] (3 PDB entries)
  8. 766197Domain d2htnh1: 2htn H:1-158 [136760]
    automatically matched to d1bcfa_
    complexed with fe, hem

Details for d2htnh1

PDB Entry: 2htn (more details), 2.5 Å

PDB Description: E. coli bacterioferritin in its as-isolated form
PDB Compounds: (H:) bacterioferritin

SCOP Domain Sequences for d2htnh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htnh1 a.25.1.1 (H:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOP Domain Coordinates for d2htnh1:

Click to download the PDB-style file with coordinates for d2htnh1.
(The format of our PDB-style files is described here.)

Timeline for d2htnh1: