Lineage for d2hthb1 (2hth B:3-131)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673437Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein)
    PfamB 030385
  6. 673438Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species)
  7. 673442Species Human (Homo sapiens) [TaxId:9606] [141444] (1 PDB entry)
  8. 673443Domain d2hthb1: 2hth B:3-131 [136743]
    Other proteins in same PDB: d2htha1

Details for d2hthb1

PDB Entry: 2hth (more details), 2.7 Å

PDB Description: structural basis for ubiquitin recognition by the human eap45/escrt-ii glue domain
PDB Compounds: (B:) vacuolar protein sorting protein 36

SCOP Domain Sequences for d2hthb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]}
rfvwtsglleinetlviqqrgvriydgeekikfdagtlllsthrliwrdqknheccmail
lsqivfieeqaagigksakivvhlhpappnkepgpfqssknsyiklsfkehgqiefyrrl
seemtqrrw

SCOP Domain Coordinates for d2hthb1:

Click to download the PDB-style file with coordinates for d2hthb1.
(The format of our PDB-style files is described here.)

Timeline for d2hthb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2htha1