SCOP 1.75: Domain d2ht0a1: 2ht0 A:2-97

Lineage for d2ht0a1 (2ht0 A:2-97)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)

6. Protein Integration host factor alpha subunit (IHFA) [88878] (1 species)
   heterodimer of two related subunits

7. Species Escherichia coli [TaxId:562] [88879] (5 PDB entries)

8. Domain d2ht0a1: 2ht0 A:2-97 [136728]
   Other proteins in same PDB: d2ht0b1
   automatically matched to d1ihfa_
   complexed with cd

Details for d2ht0a1

PDB Entry: 2ht0, 2 Å

PDB Description: IHF bound to doubly nicked DNA

PDB Compounds: (A:) Integration host factor alpha-subunit

SCOP Domain Sequences for d2ht0a1:

Sequence; same for both SEQRES and ATOM records:

>d2ht0a1 a.55.1.1 (A:2-97) Integration host factor alpha subunit (IHFA) {Escherichia coli [TaxId: 562]}
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk

Timeline for d2ht0a1:

• d2ht0a1 first appeared in SCOP 1.73
  
• d2ht0a1 is called d2ht0a_ in SCOPe 2.01
  
• d2ht0a1 appears in the current release, SCOPe 2.08, called d2ht0a_