Lineage for d2hr5b2 (2hr5 B:135-171)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1705990Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 1705991Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 1706093Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 1706105Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)
  8. 1706109Domain d2hr5b2: 2hr5 B:135-171 [136685]
    Other proteins in same PDB: d2hr5a1, d2hr5b1
    automated match to d1nnqa2
    complexed with fe

Details for d2hr5b2

PDB Entry: 2hr5 (more details), 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form
PDB Compounds: (B:) rubrerythrin

SCOPe Domain Sequences for d2hr5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr5b2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d2hr5b2:

Click to download the PDB-style file with coordinates for d2hr5b2.
(The format of our PDB-style files is described here.)

Timeline for d2hr5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hr5b1