SCOPe 2.01: Domain d2hr5b2: 2hr5 B:135-171

Lineage for d2hr5b2 (2hr5 B:135-171)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubrerythrin, C-terminal domain [57811] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)

8. Domain d2hr5b2: 2hr5 B:135-171 [136685]
   Other proteins in same PDB: d2hr5a1, d2hr5b1
   automatically matched to d1nnqa2
   complexed with fe

Details for d2hr5b2

PDB Entry: 2hr5, 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form

PDB Compounds: (B:) rubrerythrin

SCOPe Domain Sequences for d2hr5b2:

Sequence; same for both SEQRES and ATOM records:

>d2hr5b2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

Timeline for d2hr5b2:

• d2hr5b2 first appeared in SCOP 1.73
  
• d2hr5b2 appears in SCOP 1.75
  
• d2hr5b2 appears in SCOPe 2.02
  
• d2hr5b2 appears in the current release, SCOPe 2.08