Lineage for d2hr5b2 (2hr5 B:135-171)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892941Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 893109Superfamily g.41.5: Rubredoxin-like [57802] (3 families) (S)
  5. 893110Family g.41.5.1: Rubredoxin [57803] (4 proteins)
  6. 893182Protein Rubrerythrin, C-terminal domain [57811] (2 species)
  7. 893183Species Archaeon Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries)
  8. 893187Domain d2hr5b2: 2hr5 B:135-171 [136685]
    Other proteins in same PDB: d2hr5a1, d2hr5b1
    automatically matched to d1nnqa2
    complexed with fe

Details for d2hr5b2

PDB Entry: 2hr5 (more details), 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form
PDB Compounds: (B:) rubrerythrin

SCOP Domain Sequences for d2hr5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr5b2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOP Domain Coordinates for d2hr5b2:

Click to download the PDB-style file with coordinates for d2hr5b2.
(The format of our PDB-style files is described here.)

Timeline for d2hr5b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hr5b1