![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.5: Rubredoxin-like [57802] (3 families) ![]() |
![]() | Family g.41.5.1: Rubredoxin [57803] (4 proteins) |
![]() | Protein Rubrerythrin, C-terminal domain [57811] (2 species) |
![]() | Species Archaeon Pyrococcus furiosus [TaxId:2261] [103622] (2 PDB entries) |
![]() | Domain d2hr5b2: 2hr5 B:135-171 [136685] Other proteins in same PDB: d2hr5a1, d2hr5b1 automatically matched to d1nnqa2 complexed with fe |
PDB Entry: 2hr5 (more details), 2.7 Å
SCOP Domain Sequences for d2hr5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hr5b2 g.41.5.1 (B:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} eikkvyicpicgytavdeapeycpvcgapkekfvvfe
Timeline for d2hr5b2: