Class a: All alpha proteins [46456] (286 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein Rubrerythrin, N-terminal domain [47242] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries) |
Domain d2hr5b1: 2hr5 B:2-134 [136684] Other proteins in same PDB: d2hr5a2, d2hr5b2 automated match to d1nnqa1 complexed with fe |
PDB Entry: 2hr5 (more details), 2.7 Å
SCOPe Domain Sequences for d2hr5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hr5b1 a.25.1.1 (B:2-134) Rubrerythrin, N-terminal domain {Pyrococcus furiosus [TaxId: 2261]} vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely rkakekaekgedi
Timeline for d2hr5b1: