SCOP 1.75: Domain d2hr5b1: 2hr5 B:2-134

Lineage for d2hr5b1 (2hr5 B:2-134)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (9 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries)

8. Domain d2hr5b1: 2hr5 B:2-134 [136684]
   Other proteins in same PDB: d2hr5a2, d2hr5b2
   automatically matched to d1nnqa1
   complexed with fe

Details for d2hr5b1

PDB Entry: 2hr5, 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form

PDB Compounds: (B:) rubrerythrin

SCOP Domain Sequences for d2hr5b1:

Sequence; same for both SEQRES and ATOM records:

>d2hr5b1 a.25.1.1 (B:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

Timeline for d2hr5b1:

• d2hr5b1 first appeared in SCOP 1.73
  
• d2hr5b1 appears in SCOPe 2.01
  
• d2hr5b1 appears in the current release, SCOPe 2.08