Lineage for d2hr5b1 (2hr5 B:2-134)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 639084Protein Rubrerythrin, N-terminal domain [47242] (2 species)
  7. 639085Species Archaeon Pyrococcus furiosus [TaxId:2261] [101129] (2 PDB entries)
  8. 639089Domain d2hr5b1: 2hr5 B:2-134 [136684]
    Other proteins in same PDB: d2hr5a2, d2hr5b2
    automatically matched to d1nnqa1
    complexed with fe

Details for d2hr5b1

PDB Entry: 2hr5 (more details), 2.7 Å

PDB Description: PF1283- Rubrerythrin from Pyrococcus furiosus iron bound form
PDB Compounds: (B:) rubrerythrin

SCOP Domain Sequences for d2hr5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hr5b1 a.25.1.1 (B:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}
vvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfi
algklgktpenlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaely
rkakekaekgedi

SCOP Domain Coordinates for d2hr5b1:

Click to download the PDB-style file with coordinates for d2hr5b1.
(The format of our PDB-style files is described here.)

Timeline for d2hr5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hr5b2