Lineage for d2hqxa1 (2hqx A:8-97)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665781Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families) (S)
  5. 665782Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 665800Protein P100 co-activator, SND1 [141207] (1 species)
  7. 665801Species Human (Homo sapiens) [TaxId:9606] [141208] (1 PDB entry)
  8. 665802Domain d2hqxa1: 2hqx A:8-97 [136675]

Details for d2hqxa1

PDB Entry: 2hqx (more details), 1.42 Å

PDB Description: Crystal structure of human P100 tudor domain conserved region
PDB Compounds: (A:) p100 co-activator tudor domain

SCOP Domain Sequences for d2hqxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]}
tqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyi
dygnrevlpstrlgtlspafstrvlpaqat

SCOP Domain Coordinates for d2hqxa1:

Click to download the PDB-style file with coordinates for d2hqxa1.
(The format of our PDB-style files is described here.)

Timeline for d2hqxa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hqxb1