SCOP 1.73: Domain d2hmob1: 2hmo B:3-194

Lineage for d2hmob1 (2hmo B:3-194)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (13 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (4 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54440] (16 PDB entries)

8. Domain d2hmob1: 2hmo B:3-194 [136602]
   Other proteins in same PDB: d2hmoa1, d2hmoa2
   automatically matched to d1eg9b_
   complexed with 3nt, edo, fe, fes, so4

Details for d2hmob1

PDB Entry: 2hmo, 1.6 Å

PDB Description: Crystal Structure of Naphthalene 1,2-Dioxygenase Bound to 3-Nitrotoluene.

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOP Domain Sequences for d2hmob1:

Sequence; same for both SEQRES and ATOM records:

>d2hmob1 d.17.4.4 (B:3-194) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

Timeline for d2hmob1:

• d2hmob1 is new in SCOP 1.73
  
• d2hmob1 appears in SCOP 1.75
  
• d2hmob1 appears in the current release, SCOPe 2.08, called d2hmob_