Lineage for d2hmna1 (2hmn A:1-154)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 945968Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 945969Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 946051Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 946066Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species)
  7. 946067Species Pseudomonas putida [TaxId:303] [50035] (16 PDB entries)
  8. 946074Domain d2hmna1: 2hmn A:1-154 [136597]
    Other proteins in same PDB: d2hmna2, d2hmnb_
    automatically matched to d1eg9a1
    complexed with an3, edo, fe, fes, so4; mutant

Details for d2hmna1

PDB Entry: 2hmn (more details), 1.7 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to anthracene.
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmna1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d2hmna1:

Click to download the PDB-style file with coordinates for d2hmna1.
(The format of our PDB-style files is described here.)

Timeline for d2hmna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmna2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hmnb_