SCOPe 2.06: Domain d2hmlb_: 2hml B:

Lineage for d2hmlb_ (2hml B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)

8. Domain d2hmlb_: 2hml B: [136593]
   Other proteins in same PDB: d2hmla1, d2hmla2
   automated match to d1eg9b_
   complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmlb_

PDB Entry: 2hml, 1.8 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmlb_:

Sequence; same for both SEQRES and ATOM records:

>d2hmlb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

Timeline for d2hmlb_:

• d2hmlb_ first appeared in SCOP 1.73, called d2hmlb1
  
• d2hmlb_ appears in SCOPe 2.05
  
• d2hmlb_ appears in SCOPe 2.07
  
• d2hmlb_ appears in the current release, SCOPe 2.08