Lineage for d2hmlb_ (2hml B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020265Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 1020277Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (3 species)
  7. 1020291Species Pseudomonas sp. [TaxId:306] [187132] (6 PDB entries)
  8. 1020297Domain d2hmlb_: 2hml B: [136593]
    Other proteins in same PDB: d2hmla1, d2hmla2
    automated match to d1eg9b_
    complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmlb_

PDB Entry: 2hml (more details), 1.8 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmlb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d2hmlb_:

Click to download the PDB-style file with coordinates for d2hmlb_.
(The format of our PDB-style files is described here.)

Timeline for d2hmlb_: