SCOPe 2.04: Domain d2hmkb_: 2hmk B:

Lineage for d2hmkb_ (2hmk B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas sp. [TaxId:306] [187132] (7 PDB entries)

8. Domain d2hmkb_: 2hmk B: [136590]
   Other proteins in same PDB: d2hmka1, d2hmka2
   automated match to d1eg9b_
   complexed with edo, fe, fes, pey, so4

Details for d2hmkb_

PDB Entry: 2hmk, 1.65 Å

PDB Description: crystal structure of naphthalene 1,2-dioxygenase bound to phenanthrene

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOPe Domain Sequences for d2hmkb_:

Sequence; same for both SEQRES and ATOM records:

>d2hmkb_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 306]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

Timeline for d2hmkb_:

• d2hmkb_ first appeared in SCOP 1.73, called d2hmkb1
  
• d2hmkb_ appears in SCOPe 2.03
  
• d2hmkb_ appears in SCOPe 2.05
  
• d2hmkb_ appears in the current release, SCOPe 2.08