Lineage for d2hmfb2 (2hmf B:404-470)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725399Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 725400Protein Aspartokinase [143391] (3 species)
  7. 725408Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry)
  8. 725411Domain d2hmfb2: 2hmf B:404-470 [136577]
    Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1
    automatically matched to 2HMF A:404-470
    complexed with adp, asp, mg

Details for d2hmfb2

PDB Entry: 2hmf (more details), 2.7 Å

PDB Description: structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
PDB Compounds: (B:) Probable aspartokinase

SCOP Domain Sequences for d2hmfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmfb2 d.58.18.10 (B:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfiek

SCOP Domain Coordinates for d2hmfb2:

Click to download the PDB-style file with coordinates for d2hmfb2.
(The format of our PDB-style files is described here.)

Timeline for d2hmfb2: