SCOPe 2.05: Domain d2hlff2: 2hlf F:107-210

Lineage for d2hlff2 (2hlf F:107-210)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (346 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d2hlff2: 2hlf F:107-210 [136569]
   Other proteins in same PDB: d2hlfa1, d2hlfb1, d2hlfd1, d2hlff1
   automatically matched to d1dqdl2
   complexed with br; mutant

Details for d2hlff2

PDB Entry: 2hlf, 3.3 Å

PDB Description: structure of the escherichis coli clc chloride channel y445e mutant and fab complex

PDB Compounds: (F:) Fab fragment, light chain

SCOPe Domain Sequences for d2hlff2:

Sequence; same for both SEQRES and ATOM records:

>d2hlff2 b.1.1.2 (F:107-210) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d2hlff2:

• d2hlff2 first appeared in SCOP 1.73
  
• d2hlff2 appears in SCOPe 2.04
  
• d2hlff2 appears in SCOPe 2.06
  
• d2hlff2 appears in the current release, SCOPe 2.08