SCOP 1.75: Domain d2hl5b1: 2hl5 B:194-249

Lineage for d2hl5b1 (2hl5 B:194-249)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (1 protein)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (6 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d2hl5b1: 2hl5 B:194-249 [136560]
   automatically matched to 1WU9 A:191-249
   complexed with cl; mutant

Details for d2hl5b1

PDB Entry: 2hl5, 1.93 Å

PDB Description: crystal structure of the c-terminal domain of human eb1 in complex with the a49m mutant cap-gly domain of human dynactin-1 (p150-glued)

PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOP Domain Sequences for d2hl5b1:

Sequence; same for both SEQRES and ATOM records:

>d2hl5b1 a.245.1.1 (B:194-249) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
aelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilyat

Timeline for d2hl5b1:

• d2hl5b1 first appeared in SCOP 1.73
  
• d2hl5b1 is called d2hl5b_ in SCOPe 2.01
  
• d2hl5b1 appears in the current release, SCOPe 2.08, called d2hl5b_