Lineage for d2hkja2 (2hkj A:307-470)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716671Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 716672Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 716795Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 716830Protein Topoisomerase VI-B subunit [82577] (1 species)
    contains an H2TH domain inserted in front of this domain and after the N-terminal ATPase domain
  7. 716831Species Archaeon Sulfolobus shibatae [TaxId:2286] [82578] (7 PDB entries)
  8. 716832Domain d2hkja2: 2hkj A:307-470 [136554]
    Other proteins in same PDB: d2hkja1, d2hkja3
    automatically matched to d1mu5a2
    complexed with dms, mg, rdc

Details for d2hkja2

PDB Entry: 2hkj (more details), 2 Å

PDB Description: Topoisomerase VI-B bound to radicicol
PDB Compounds: (A:) Type II DNA topoisomerase VI subunit B

SCOP Domain Sequences for d2hkja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkja2 d.14.1.3 (A:307-470) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]}
rspsadslsvigedlielglkkifnpdfaasitrkpkayqghpfiveagvafggsipvge
epivlryankipliydeksdviwkvveeldwkrygiesdqyqmvvmvhlcstkipyksag
kesiaevediekeiknalmevarklkqylsekrkeqeakkklla

SCOP Domain Coordinates for d2hkja2:

Click to download the PDB-style file with coordinates for d2hkja2.
(The format of our PDB-style files is described here.)

Timeline for d2hkja2: