SCOP 1.73: Domain d2hk5a1: 2hk5 A:230-497

Lineage for d2hk5a1 (2hk5 A:230-497)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Haemopoetic cell kinase Hck [56151] (1 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56152] (4 PDB entries)

8. Domain d2hk5a1: 2hk5 A:230-497 [136549]
   automatically matched to d1qcfa3
   complexed with 1bm

Details for d2hk5a1

PDB Entry: 2hk5, 2 Å

PDB Description: hck kinase in complex with lck targetted inhibitor pg-1009247

PDB Compounds: (A:) Tyrosine-protein kinase HCK

SCOP Domain Sequences for d2hk5a1:

Sequence; same for both SEQRES and ATOM records:

>d2hk5a1 d.144.1.7 (A:230-497) Haemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
qkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaea
nvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqia
egmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtap
eainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeel
ynimmrcwknrpeerptfeyiqsvlddf

Timeline for d2hk5a1:

• d2hk5a1 is new in SCOP 1.73
  
• d2hk5a1 appears in SCOP 1.75
  
• d2hk5a1 appears in the current release, SCOPe 2.08, called d2hk5a2