Lineage for d2hjsa2 (2hjs A:130-319)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527131Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2527132Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2527133Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2527497Protein Usg-1 protein homolog PA3116 [143542] (1 species)
  7. 2527498Species Pseudomonas aeruginosa [TaxId:287] [143543] (1 PDB entry)
    Uniprot O87014 130-319
  8. 2527499Domain d2hjsa2: 2hjs A:130-319 [136548]
    Other proteins in same PDB: d2hjsa1
    complexed with dio

Details for d2hjsa2

PDB Entry: 2hjs (more details), 2.2 Å

PDB Description: The structure of a probable aspartate-semialdehyde dehydrogenase from Pseudomonas aeruginosa
PDB Compounds: (A:) USG-1 protein homolog

SCOPe Domain Sequences for d2hjsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]}
cavaaelcevlapllatldcrqlnltaclsvsslgregvkelarqtaellnarpleprlf
drqiafnllaqvgavdaeghsaierrifaevqallgerigplnvtciqapvffgdslsvt
lqcaepvdlaavtrvldatkgiewvgegdyptvvgdalgqdetyvgrvragqadpcqvnl
wivsdnvrkg

SCOPe Domain Coordinates for d2hjsa2:

Click to download the PDB-style file with coordinates for d2hjsa2.
(The format of our PDB-style files is described here.)

Timeline for d2hjsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hjsa1