SCOP 1.73: Domain d2hjsa1: 2hjs A:3-129,A:320-336

Lineage for d2hjsa1 (2hjs A:3-129,A:320-336)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Usg-1 protein homolog PA3116 [141923] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141924] (1 PDB entry)

8. Domain d2hjsa1: 2hjs A:3-129,A:320-336 [136547]
   Other proteins in same PDB: d2hjsa2
   complexed with dio

Details for d2hjsa1

PDB Entry: 2hjs, 2.2 Å

PDB Description: The structure of a probable aspartate-semialdehyde dehydrogenase from Pseudomonas aeruginosa

PDB Compounds: (A:) USG-1 protein homolog

SCOP Domain Sequences for d2hjsa1:

Sequence; same for both SEQRES and ATOM records:

>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]}
qplnvavvgatgsvgealvgllderdfplhrlhllasaesagqrmgfaesslrvgdvdsf
dfssvglaffaaaaevsrahaeraraagcsvidlsgalepsvappvmvsvnaerlasqaa
pfllsspXaalnavllgellikhyl

Timeline for d2hjsa1:

• d2hjsa1 is new in SCOP 1.73
  
• d2hjsa1 appears in SCOP 1.75
  
• d2hjsa1 appears in the current release, SCOPe 2.08