Lineage for d2hjla1 (2hjl A:182-274)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106700Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1106712Domain d2hjla1: 2hjl A:182-274 [136544]
    Other proteins in same PDB: d2hjla2, d2hjlb_
    automatically matched to d1a1ma1

Details for d2hjla1

PDB Entry: 2hjl (more details), 1.5 Å

PDB Description: Crystal Structure of HLA-B5703 and HIV-1 peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen B-57

SCOPe Domain Sequences for d2hjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjla1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpisdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrw

SCOPe Domain Coordinates for d2hjla1:

Click to download the PDB-style file with coordinates for d2hjla1.
(The format of our PDB-style files is described here.)

Timeline for d2hjla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hjla2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hjlb_