SCOP 1.75: Domain d2hjfc1: 2hjf C:22-124

Lineage for d2hjfc1 (2hjf C:22-124)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (28 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d2hjfc1: 2hjf C:22-124 [136540]
   automatically matched to d1k4cc_
   complexed with k, tba; mutant

Details for d2hjfc1

PDB Entry: 2hjf, 2.9 Å

PDB Description: potassium channel kcsa-fab complex with tetrabutylammonium (tba)

PDB Compounds: (C:) Voltage-gated potassium channel

SCOP Domain Sequences for d2hjfc1:

Sequence; same for both SEQRES and ATOM records:

>d2hjfc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2hjfc1:

• d2hjfc1 first appeared in SCOP 1.73
  
• d2hjfc1 is called d2hjfc_ in SCOPe 2.01
  
• d2hjfc1 appears in the current release, SCOPe 2.08, called d2hjfc_