Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein automated matches [190184] (3 species) not a true protein |
Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries) |
Domain d2hjfc_: 2hjf C: [136540] Other proteins in same PDB: d2hjfa1, d2hjfa2, d2hjfa3, d2hjfb1, d2hjfb2 automated match to d1k4cc_ complexed with k, tba |
PDB Entry: 2hjf (more details), 2.9 Å
SCOPe Domain Sequences for d2hjfc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hjfc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2hjfc_: