SCOPe 2.08: Domain d2hjfc_: 2hjf C:

Lineage for d2hjfc_ (2hjf C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d2hjfc_: 2hjf C: [136540]
   Other proteins in same PDB: d2hjfa1, d2hjfa2, d2hjfa3, d2hjfb1, d2hjfb2
   automated match to d1k4cc_
   complexed with k, tba

Details for d2hjfc_

PDB Entry: 2hjf, 2.9 Å

PDB Description: potassium channel kcsa-fab complex with tetrabutylammonium (tba)

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2hjfc_:

Sequence; same for both SEQRES and ATOM records:

>d2hjfc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2hjfc_:

• d2hjfc_ first appeared in SCOP 1.73, called d2hjfc1
  
• d2hjfc_ appears in SCOPe 2.07