SCOPe 2.04: Domain d2hj9a_: 2hj9 A:

Lineage for d2hj9a_ (2hj9 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins)

6. Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)

7. Species Vibrio harveyi [TaxId:669] [69623] (3 PDB entries)

8. Domain d2hj9a_: 2hj9 A: [136538]
   Other proteins in same PDB: d2hj9c1, d2hj9d_
   automated match to d1jx6a_
   complexed with ai2

Details for d2hj9a_

PDB Entry: 2hj9, 2.34 Å

PDB Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ

PDB Compounds: (A:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d2hj9a_:

Sequence; same for both SEQRES and ATOM records:

>d2hj9a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysdn

Timeline for d2hj9a_:

• d2hj9a_ first appeared in SCOP 1.73, called d2hj9a1
  
• d2hj9a_ appears in SCOPe 2.03
  
• d2hj9a_ appears in SCOPe 2.05
  
• d2hj9a_ appears in the current release, SCOPe 2.08