SCOPe 2.01: Domain d2hi6a1: 2hi6 A:1-132

Lineage for d2hi6a1 (2hi6 A:1-132)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families)
   contains mixed beta-sheet barrel, closed n=7, S=10

5. Family c.8.2.3: AF0055-like [141979] (1 protein)
   PF01989; DUF126; probable link between the LeuD-like and Phosphohistidine domain superfamilies (sequence similarity crosshits)

6. Protein Hypothetical protein AF0055 [141980] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [141981] (1 PDB entry)
   Uniprot O30181 1-132

8. Domain d2hi6a1: 2hi6 A:1-132 [136523]

Details for d2hi6a1

PDB Entry: 2hi6

PDB Description: solution nmr structure of upf0107 protein af_0055, northeast structural genomics consortium target gr101

PDB Compounds: (A:) UPF0107 protein AF0055

SCOPe Domain Sequences for d2hi6a1:

Sequence; same for both SEQRES and ATOM records:

>d2hi6a1 c.8.2.3 (A:1-132) Hypothetical protein AF0055 {Archaeoglobus fulgidus [TaxId: 2234]}
vkfacraitrgraegealvtkeyisflggidketgivkedceikgesvagrilvfpggkg
stvgsyvllnlrkngvapkaiinkktetiiavgaamaeiplvevrdekffeavktgdrvv
vnadegyvelie

Timeline for d2hi6a1:

• d2hi6a1 first appeared in SCOP 1.73
  
• d2hi6a1 appears in SCOP 1.75
  
• d2hi6a1 appears in SCOPe 2.02
  
• d2hi6a1 appears in the current release, SCOPe 2.08