SCOPe 2.06: Domain d2hhwa2: 2hhw A:469-876

Lineage for d2hhwa2 (2hhw A:469-876)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein DNA polymerase I (Klenow fragment) [56674] (3 species)

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries)
   Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462
   Uniprot Q45458 298-876 # 88% sequence identity

8. Domain d2hhwa2: 2hhw A:469-876 [136517]
   Other proteins in same PDB: d2hhwa1, d2hhwd1
   automatically matched to d1l3sa2
   protein/DNA complex; complexed with 23t, mn, so4, suc

Details for d2hhwa2

PDB Entry: 2hhw, 1.88 Å

PDB Description: ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hhwa2:

Sequence; same for both SEQRES and ATOM records:

>d2hhwa2 e.8.1.1 (A:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni
nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi
egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl
ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav
nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh
rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv
hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak

Timeline for d2hhwa2:

• d2hhwa2 first appeared in SCOP 1.73
  
• d2hhwa2 appears in SCOPe 2.05
  
• d2hhwa2 appears in SCOPe 2.07
  
• d2hhwa2 appears in the current release, SCOPe 2.08