Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (43 PDB entries) Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462 |
Domain d2hhsa1: 2hhs A:298-468 [136508] Other proteins in same PDB: d2hhsa2 automatically matched to d1l3sa1 protein/DNA complex; complexed with mg, so4, suc |
PDB Entry: 2hhs (more details), 1.8 Å
SCOPe Domain Sequences for d2hhsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhsa1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d2hhsa1: