Lineage for d2hhpa1 (2hhp A:202-351)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284826Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
    core: 5-helical bundle; up-and-down; right-handed twist
  4. 1284827Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (6 families) (S)
    this domain follows the catalytic nucleotidyltransferase domain
  5. 1284828Family a.160.1.1: Poly(A) polymerase, PAP, middle domain [81630] (1 protein)
  6. 1284829Protein Poly(A) polymerase, PAP, middle domain [81629] (2 species)
  7. 1284830Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81628] (5 PDB entries)
  8. 1284832Domain d2hhpa1: 2hhp A:202-351 [136503]
    Other proteins in same PDB: d2hhpa2, d2hhpa3
    automatically matched to d1fa0a3
    complexed with flc, mg

Details for d2hhpa1

PDB Entry: 2hhp (more details), 1.8 Å

PDB Description: Structure of yeast poly(A) polymerase in a closed conformation.
PDB Compounds: (A:) poly(a) polymerase

SCOPe Domain Sequences for d2hhpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhpa1 a.160.1.1 (A:202-351) Poly(A) polymerase, PAP, middle domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pkpnvfrialraiklwaqrravyanifgfpggvawamlvaricqlypnacsavilnrffi
ilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvitpaypsmcathnitestk
kvilqefvrgvqitndifsnkkswanlfek

SCOPe Domain Coordinates for d2hhpa1:

Click to download the PDB-style file with coordinates for d2hhpa1.
(The format of our PDB-style files is described here.)

Timeline for d2hhpa1: