SCOPe 2.01: Domain d2hhhs1: 2hhh S:2-81

Lineage for d2hhhs1 (2hhh S:2-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54573] (38 PDB entries)
   Uniprot P80381

8. Domain d2hhhs1: 2hhh S:2-81 [136495]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhht1, d2hhhu1
   automatically matched to d1fjgs_
   complexed with ksg

Details for d2hhhs1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2hhhs1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhs1 d.28.1.1 (S:2-81) Ribosomal protein S19 {Thermus thermophilus [TaxId: 274]}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

Timeline for d2hhhs1:

• d2hhhs1 first appeared in SCOP 1.73
  
• d2hhhs1 appears in SCOP 1.75
  
• d2hhhs1 appears in SCOPe 2.02
  
• d2hhhs1 appears in the current release, SCOPe 2.08