Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S17 [50304] (3 species) |
Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries) Uniprot P24321 |
Domain d2hhhq1: 2hhh Q:2-105 [136493] Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1 automatically matched to d1fjgq_ complexed with ksg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2hhh (more details), 3.35 Å
SCOPe Domain Sequences for d2hhhq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhhq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]} pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
Timeline for d2hhhq1: