SCOPe 2.05: Domain d2hhhp1: 2hhh P:1-83

Lineage for d2hhhp1 (2hhh P:1-83)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
   Uniprot P80379

8. Domain d2hhhp1: 2hhh P:1-83 [136492]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
   automatically matched to d1emwa_
   complexed with ksg

Details for d2hhhp1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2hhhp1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d2hhhp1:

• d2hhhp1 first appeared in SCOP 1.73
  
• d2hhhp1 appears in SCOPe 2.04
  
• d2hhhp1 appears in SCOPe 2.06
  
• d2hhhp1 appears in the current release, SCOPe 2.08