Lineage for d2hhhj1 (2hhh J:3-100)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196721Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 2196722Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 2196723Protein Ribosomal protein S10 [55001] (2 species)
  7. 2196749Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 2196774Domain d2hhhj1: 2hhh J:3-100 [136486]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1fjgj_
    complexed with ksg

Details for d2hhhj1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2hhhj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2hhhj1:

Click to download the PDB-style file with coordinates for d2hhhj1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhj1: