SCOPe 2.05: Domain d2hhhi1: 2hhh I:2-128

Lineage for d2hhhi1 (2hhh I:2-128)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Ribosomal protein S9 [54218] (2 species)

7. Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
   Uniprot P80374

8. Domain d2hhhi1: 2hhh I:2-128 [136485]
   Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
   automatically matched to d1fjgi_
   complexed with ksg

Details for d2hhhi1

PDB Entry: 2hhh, 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit

PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2hhhi1:

Sequence; same for both SEQRES and ATOM records:

>d2hhhi1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

Timeline for d2hhhi1:

• d2hhhi1 first appeared in SCOP 1.73
  
• d2hhhi1 appears in SCOPe 2.04
  
• d2hhhi1 appears in SCOPe 2.06
  
• d2hhhi1 appears in the current release, SCOPe 2.08