Lineage for d2hhhh1 (2hhh H:1-138)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217010Fold d.140: Ribosomal protein S8 [56046] (1 superfamily)
    consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a
  4. 2217011Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) (S)
    automatically mapped to Pfam PF00410
  5. 2217012Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein)
  6. 2217013Protein Ribosomal protein S8 [56049] (4 species)
  7. 2217031Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries)
    Uniprot P24319
  8. 2217058Domain d2hhhh1: 2hhh H:1-138 [136484]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1fjgh_
    complexed with ksg

Details for d2hhhh1

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (H:) 30S ribosomal protein S8

SCOPe Domain Sequences for d2hhhh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhh1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOPe Domain Coordinates for d2hhhh1:

Click to download the PDB-style file with coordinates for d2hhhh1.
(The format of our PDB-style files is described here.)

Timeline for d2hhhh1: