![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
![]() | Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
![]() | Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
![]() | Protein Ribosomal protein S5, C-terminal domain [54215] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54217] (36 PDB entries) Uniprot P27152 ! Uniprot P80373 |
![]() | Domain d2hhhe1: 2hhh E:74-154 [136480] Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhc2, d2hhhd1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1 automatically matched to d1i94e1 complexed with ksg |
PDB Entry: 2hhh (more details), 3.35 Å
SCOPe Domain Sequences for d2hhhe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhhe1 d.14.1.1 (E:74-154) Ribosomal protein S5, C-terminal domain {Thermus thermophilus [TaxId: 274]} gtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelgsrnpiniay atmealrqlrtkadverlrkg
Timeline for d2hhhe1: