Lineage for d2hhhc2 (2hhh C:107-207)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191177Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2191178Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2191179Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2191180Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2191206Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2191228Domain d2hhhc2: 2hhh C:107-207 [136478]
    Other proteins in same PDB: d2hhhb1, d2hhhc1, d2hhhd1, d2hhhe1, d2hhhe2, d2hhhf1, d2hhhg1, d2hhhh1, d2hhhi1, d2hhhj1, d2hhhk1, d2hhhl1, d2hhhm1, d2hhhn1, d2hhho1, d2hhhp1, d2hhhq1, d2hhhr1, d2hhhs1, d2hhht1, d2hhhu1
    automatically matched to d1fjgc2
    complexed with ksg

Details for d2hhhc2

PDB Entry: 2hhh (more details), 3.35 Å

PDB Description: Crystal structure of kasugamycin bound to the 30S ribosomal subunit
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2hhhc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhhc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d2hhhc2:

Click to download the PDB-style file with coordinates for d2hhhc2.
(The format of our PDB-style files is described here.)

Timeline for d2hhhc2: