Lineage for d2hhaa1 (2hha A:39-508)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2809844Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2810010Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2810011Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2810018Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2810019Species Human (Homo sapiens) [TaxId:9606] [82174] (98 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2810120Domain d2hhaa1: 2hha A:39-508 [136470]
    Other proteins in same PDB: d2hhaa2, d2hhab2
    automated match to d1orva1
    complexed with 3tp, na, nag

Details for d2hhaa1

PDB Entry: 2hha (more details), 2.35 Å

PDB Description: the structure of dpp4 in complex with an oxadiazole inhibitor
PDB Compounds: (A:) Hypothetical protein DPP4

SCOPe Domain Sequences for d2hhaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhaa1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d2hhaa1:

Click to download the PDB-style file with coordinates for d2hhaa1.
(The format of our PDB-style files is described here.)

Timeline for d2hhaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hhaa2