Lineage for d2hh0l1 (2hh0 L:2-149)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104938Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (184 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. 1105162Domain d2hh0l1: 2hh0 L:2-149 [136464]
    Other proteins in same PDB: d2hh0h1, d2hh0h2, d2hh0l2
    chimera with human C domain

Details for d2hh0l1

PDB Entry: 2hh0 (more details), 2.85 Å

PDB Description: structure of an anti-prp fab, p-clone, in complex with its cognate bovine peptide epitope.
PDB Compounds: (L:) Light Chain, P-Clone Fab, Chimera

SCOPe Domain Sequences for d2hh0l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hh0l1 b.1.1.1 (L:2-149) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
lvmtqtpsslsaslgervsltcrasqdignnlnwiqqkpdgtikrliyatssldsgvpkr
fsgsrsgsdysltisslesedfadyyclqhdtfpltfgggtkleikr

SCOPe Domain Coordinates for d2hh0l1:

Click to download the PDB-style file with coordinates for d2hh0l1.
(The format of our PDB-style files is described here.)

Timeline for d2hh0l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hh0l2