SCOPe 2.03: Domain d2hh0h2: 2hh0 H:152-271

Lineage for d2hh0h2 (2hh0 H:152-271)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (177 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2hh0h2: 2hh0 H:152-271 [136463]
   Other proteins in same PDB: d2hh0h1, d2hh0l1, d2hh0l2

Details for d2hh0h2

PDB Entry: 2hh0, 2.85 Å

PDB Description: structure of an anti-prp fab, p-clone, in complex with its cognate bovine peptide epitope.

PDB Compounds: (H:) Heavy Chain, P-Clone Fab, Chimera

SCOPe Domain Sequences for d2hh0h2:

Sequence; same for both SEQRES and ATOM records:

>d2hh0h2 b.1.1.2 (H:152-271) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskaggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d2hh0h2:

• d2hh0h2 first appeared in SCOP 1.73
  
• d2hh0h2 appears in SCOPe 2.02
  
• d2hh0h2 appears in SCOPe 2.04
  
• d2hh0h2 appears in the current release, SCOPe 2.08