Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d2hh0h2: 2hh0 H:152-271 [136463] Other proteins in same PDB: d2hh0h1, d2hh0l1, d2hh0l2 mutant |
PDB Entry: 2hh0 (more details), 2.85 Å
SCOP Domain Sequences for d2hh0h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hh0h2 b.1.1.2 (H:152-271) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} astkgpsvfplapsskaggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d2hh0h2: