![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
![]() | Domain d2hgrw1: 2hgr W:8-106 [136460] Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrs1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrx1 automatically matched to d1i94t_ protein/RNA complex |
PDB Entry: 2hgr (more details), 4.51 Å
SCOPe Domain Sequences for d2hgrw1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgrw1 a.7.6.1 (W:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d2hgrw1: