Lineage for d2hgrs1 (2hgr S:1-83)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720771Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 720772Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 720773Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 720774Protein Ribosomal protein S16 [54567] (1 species)
  7. 720775Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
  8. 720807Domain d2hgrs1: 2hgr S:1-83 [136456]
    Other proteins in same PDB: d2hgre1, d2hgrf1, d2hgrf2, d2hgrg1, d2hgrh1, d2hgrh2, d2hgri1, d2hgrj1, d2hgrk1, d2hgrm1, d2hgrn1, d2hgro1, d2hgrp1, d2hgrq1, d2hgrr1, d2hgrt1, d2hgru1, d2hgrv1, d2hgrw1
    automatically matched to d1emwa_

Details for d2hgrs1

PDB Entry: 2hgr (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGr contains 30S ribosomal subunit. The 50S ribosomal subunit can be found in PDB entry 2HGU.
PDB Compounds: (S:) 30S ribosomal protein S16

SCOP Domain Sequences for d2hgrs1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgrs1 d.27.1.1 (S:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d2hgrs1:

Click to download the PDB-style file with coordinates for d2hgrs1.
(The format of our PDB-style files is described here.)

Timeline for d2hgrs1: